Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARGFX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | ARGFX |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
ARGFX Polyclonal specifically detects ARGFX in Human samples. It is validated for Western Blot.Specifications
| ARGFX | |
| Polyclonal | |
| Purified | |
| RUO | |
| arginine-fifty homeobox | |
| ARGFX | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_001012677 | |
| 503582 | |
| Synthetic peptide directed towards the N terminal of human ARGFXThe immunogen for this antibody is ARGFX. Peptide sequence MFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQSAKQRNQILP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title