Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Argonaute 4 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595363
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595363 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595363 Supplier Invitrogen™ Supplier No. PA595363
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat thymus tissue, 22RV1 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Argonaute 4
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene AGO4
Gene Accession No. Q9HCK5
Gene Alias 5730550L01Rik; AGO4; AI481660; argonaute 4; argonaute 4, RISC catalytic component; argonaute RISC catalytic component 4; argonaute RISC catalytic subunit 4; argonaute RISC component 4; argonaute4; eIF2C 4; eIF-2C 4; Eif2c4; Eukaryotic translation initiation factor 2C 4; eukaryotic translation initiation factor 2C, 4; hAgo4; KIAA1567; LOW QUALITY PROTEIN: protein argonaute-4; mAgo4; Piwi/Argonaute family protein meIF2C4; Protein argonaute-4
Gene Symbols AGO4
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 192670, 298533
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.