Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARHGAP15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ARHGAP15 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ARHGAP15 Polyclonal specifically detects ARHGAP15 in Human samples. It is validated for Western Blot.Specifications
ARHGAP15 | |
Polyclonal | |
Rabbit | |
Q53QZ3 | |
55843 | |
Synthetic peptides corresponding to ARHGAP15(Rho GTPase activating protein 15) The peptide sequence was selected from the middle region of ARHGAP15. Peptide sequence VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ArhGAP15, BM046, Rho GTPase activating protein 15, rho GTPase-activating protein 15, Rho-type GTPase-activating protein 15 | |
ARHGAP15 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title