Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARHGAP30 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ARHGAP30 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17954720
|
Novus Biologicals
NBP17954720UL |
20 μL |
Each for $152.22
|
|
NBP179547
|
Novus Biologicals
NBP179547 |
100 μL |
Each for $436.00
|
|
Description
ARHGAP30 Polyclonal specifically detects ARHGAP30 in Human samples. It is validated for Western Blot.Specifications
| ARHGAP30 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Rho GTPase activating protein 30 | |
| ARHGAP30 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001020769 | |
| 257106 | |
| Synthetic peptide directed towards the N terminal of human ARHGAP30The immunogen for this antibody is ARHGAP30. Peptide sequence RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title