Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP256334PE

Novus Biologicals™ ARHGEF15 Recombinant Protein Antigen
SDP

Catalog No. NBP256334PE Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP256334PE 100μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP256334PE Supplier Novus Biologicals™ Supplier No. NBP256334PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARHGEF15. Source: E.coli Amino Acid Sequence: PSGSPCTPLLPMAGVLAQNGSASAPGTVRRLAGRFEGGAEGRAQDADAPEPGLQARADVNGEREAPLTGSGSQENGAPDA The ARHGEF15 Recombinant Protein Antigen is derived from E. coli. The ARHGEF15 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez) 22899
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name ARHGEF15 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias ARGEF15Rho GEF 15, E5, Ephexin5, Ephexin-5, FLJ13791, KIAA0915Vsm-RhoGEFephexin-5, MGC44868, Rho guanine exchange factor (GEF) 15, Rho guanine nucleotide exchange factor (GEF) 15, rho guanine nucleotide exchange factor 15
Gene Symbol ARHGEF15
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100μL
Regulatory Status RUO
Source E.Coli
Specific Reactivity Human
Show More Show Less

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.