ARHGEF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB406741	Novus Biologicals NBP18513025UL	25ul
NBP185130	Novus Biologicals NBP185130	0.1 mL

Description

ARHGEF3 Polyclonal specifically detects ARHGEF3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ARHGEF3
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: DKFZP434F2429, Exchange factor found in platelets and leukemic and neuronal tissues, FLJ98126, MGC118905, Rho guanine nucleotide exchange factor (GEF) 3, rho guanine nucleotide exchange factor 3,59.8 kDA protein, RhoGEF protein, XPLNXPLN
• Gene Symbols: ARHGEF3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 50650
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGETKLEQMDQSDSESDCSM
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only