Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARID1A Antibody (CL3595), Novus Biologicals™
SDP

Catalog No. NB403025 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB403025 25 μL
NBP261623 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB403025 Supplier Novus Biologicals Supplier No. NBP26162325UL
Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

ARID1A Monoclonal specifically detects ARID1A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen ARID1A
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL3595
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Gene Alias ARID domain-containing protein 1A, AT rich interactive domain 1A (SWI- like), AT rich interactive domain 1A (SWI-like), AT-rich interactive domain-containing protein 1A, B120SWI-like protein, BAF250a, BAF250SWI/SNF complex protein p270, BM029, brain protein 120, BRG1-associated factor 250, BRG1-associated factor 250a, C10rf4, C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1, chromatin remodeling factor p250, hELD, hOSA1, matrix associated, actin dependent regulator of chromatin, Osa homolog 1, OSA1, OSA1 nuclear protein, P270, SMARCF1, subfamily f, member 1
Gene Symbols ARID1A
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 8289
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.