Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARID2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ARID2 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ARID2 Polyclonal specifically detects ARID2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ARID2 | |
Polyclonal | |
Rabbit | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
196528 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLDITQQDTAKGD | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
ARID domain-containing protein 2, AT rich interactive domain 2 (ARID, RFX-like), BAF200KIAA1557AT-rich interactive domain-containing protein 2, BRG1-associated factor 200, DKFZp686G052, DKFZp779P0222, FLJ30619, p200, Zinc finger protein with activation potential, zipzap, zipzap/p200 | |
ARID2 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title