Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ARID3C Antibody, Novus Biologicals™
SDP

Catalog No. p-7109252 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179363 100 μL
NBP17936320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP179363 Supplier Novus Biologicals Supplier No. NBP179363
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ARID3C Polyclonal specifically detects ARID3C in Human samples. It is validated for Western Blot.

Specifications

Antigen ARID3C
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. A6NKF2
Gene Alias ARID domain-containing protein 3C, AT rich interactive domain 3C (BRIGHT- like), AT rich interactive domain 3C (BRIGHT-like), AT-rich interactive domain-containing protein 3C
Gene Symbols ARID3C
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human ARID3CThe immunogen for this antibody is ARID3C (NP_001017363). Peptide Sequence: MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING
Molecular Weight of Antigen 44 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 138715
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Rat: 100%; Bovine: 92%; Rabbit: 92%.
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.