Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARID5A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ARID5A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179452
|
Novus Biologicals
NBP179452 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
ARID5A Polyclonal specifically detects ARID5A in Human samples. It is validated for Western Blot.Specifications
ARID5A | |
Polyclonal | |
Rabbit | |
Human | |
ARID domain-containing protein 5A, AT rich interactive domain 5A (MRF1-like), AT-rich interactive domain-containing protein 5A, RFVG5814 | |
ARID5A | |
IgG | |
64 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q03989 | |
10865 | |
Synthetic peptide directed towards the N terminal of human ARID5AThe immunogen for this antibody is ARID5A (NP_997646). Peptide sequence MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGERE. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title