Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARID5A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ARID5A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ARID5A Polyclonal specifically detects ARID5A in Human samples. It is validated for Western Blot.Specifications
ARID5A | |
Polyclonal | |
Rabbit | |
Human | |
ARID domain-containing protein 5A, AT rich interactive domain 5A (MRF1-like), AT-rich interactive domain-containing protein 5A, RFVG5814 | |
ARID5A | |
IgG | |
64 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q03989 | |
10865 | |
Synthetic peptide directed towards the N terminal of human ARID5AThe immunogen for this antibody is ARID5A (NP_997646). Peptide sequence MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGERE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title