ARID5B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169169

Catalog No. NBP169169

Description

ARID5B Polyclonal specifically detects ARID5B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ARID5B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ARID domain-containing protein 5B, AT rich interactive domain 5B (MRF1-like), DESRTAT-rich interactive domain-containing protein 5B, FLJ21150, Modulator recognition factor 2, modulator recognition factor 2 (MRF2), MRF-2, MRF2MRF1-like protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 132 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Guinea pig: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q14865
• Gene Symbols: ARID5B
• Immunogen: Synthetic peptides corresponding to ARID5B (AT rich interactive domain 5B (MRF1-like)) The peptide sequence was selected from the C terminal of ARID5B (NP_115575). Peptide sequence: VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84159
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.