Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARIH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | ARIH1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ARIH1 Polyclonal specifically detects ARIH1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ARIH1 | |
Polyclonal | |
Rabbit | |
Human | |
25820 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHN | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
ARI-1, ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1(Drosophila), ariadne, Drosophila, homolog of, ARIMOP-6, FLJ20329, FLJ93118, H7-AP2, HARI, Monocyte protein 6, MOP6, protein ariadne-1 homolog, UbcH7-binding protein, UBCH7BPariadne (Drosophila) homolog, ubiquitin-conjugating enzyme E2-binding protein1,HHARIDKFZp686O13120, UbcM4-interacting protein, Ubiquitin-conjugating enzyme E2-binding protein 1 | |
ARIH1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title