ARL13B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155498

Catalog No. NBP155498

Description

ARL13B Polyclonal specifically detects ARL13B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ARL13B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ARL13B
• Immunogen: Synthetic peptides corresponding to ARL13B (ADP-ribosylation factor-like 13B) The peptide sequence was selected from the middle region of ARL13B. Peptide sequence RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 200894
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ADP-ribosylation factor-like 13B, ADP-ribosylation factor-like 2-like 1, ADP-ribosylation factor-like protein 13B, ADP-ribosylation factor-like protein 2-like 1, ARL2L1MGC120611, ARL2-like protein 1, DKFZp686E2075, DKFZp686L2472, DKFZp761H079, JBTS8DKFZp686M2074, MGC120612
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Yeast 80%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Yeast
• Isotype: IgG