Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARL13B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156715
Description
ARL13B Polyclonal specifically detects ARL13B in Human samples. It is validated for Western Blot.Specifications
ARL13B | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ADP-ribosylation factor-like 13B, ADP-ribosylation factor-like 2-like 1, ADP-ribosylation factor-like protein 13B, ADP-ribosylation factor-like protein 2-like 1, ARL2L1MGC120611, ARL2-like protein 1, DKFZp686E2075, DKFZp686L2472, DKFZp761H079, JBTS8DKFZp686M2074, MGC120612 | |
Rabbit | |
Affinity purified | |
RUO | |
200894 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8TCL5 | |
ARL13B | |
Synthetic peptides corresponding to ARL13B(ADP-ribosylation factor-like 13B) The peptide sequence was selected from the middle region of ARL13B. Peptide sequence VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Chicken: 92%; Canine: 92%; Mouse: 92%; Equine: 78%; Zebrafish: 78%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction