ARL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18883925UL

Catalog No. NB431082

Description

ARL3 Polyclonal specifically detects ARL3 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ARL3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: P36405
• Gene Symbols: ARL3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLI
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human ARL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ADP-ribosylation factor-like 3, ARFL3ADP-ribosylation factor-like protein 3, ARF-like 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 403
• Target Species: Human, Rat
• Isotype: IgG

For Research Use Only