ARL6IP4 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP214313	0.1 mL
NB437960	25ul

Catalog No. NBP214313 Supplier Novus Biologicals Supplier No. NBP214313

Description

Rabbit Polyclonal Antibody

ARL6IP4 Polyclonal specifically detects ARL6IP4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ARL6IP4
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Accession No.: Q66PJ3
• Gene Alias: ADP-ribosylation-like factor 6 interacting protein 4, Aip-4, ARL-6-interacting protein 4, HSP-975, HSVI binding protein, HSVI-binding protein, MGC814, SFRS20, splicing factor, arginine/serine-rich 20, splicing regulator SRrp38, SR-15, SR-25ADP-ribosylation factor-like protein 6-interacting protein 4, SRp25 nuclear protein, SRp25aip-4, SRrp37
• Gene Symbols: ARL6IP4
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KKGKEKAEAQQVEALPGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKVGVA
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51329
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only