Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARMC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ARMC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ARMC3 Polyclonal specifically detects ARMC3 in Human samples. It is validated for Western Blot.Specifications
| ARMC3 | |
| Polyclonal | |
| Rabbit | |
| armadillo repeat containing 3 | |
| ARMC3 | |
| IgG | |
| 96 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 219681 | |
| Synthetic peptides corresponding to ARMC3(armadillo repeat containing 3) The peptide sequence was selected from the middle region of ARMC3. Peptide sequence YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title