Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARMH4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Applications | Western Blot |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
ARMH4 Polyclonal specifically detects ARMH4 in Human samples. It is validated for Western Blot.Specifications
Western Blot | |
Unconjugated | |
RUO | |
145407 | |
Synthetic peptides corresponding to C14ORF37 The peptide sequence was selected from the N terminal of C14ORF37. Peptide sequence EIAHVHAEKGQSDKMNTDDLENSSVTSKQTPQLVVSEDPMMMSAVPSATS. | |
Primary |
Polyclonal | |
Rabbit | |
c14_5376, chromosome 14 open reading frame 37 | |
C14ORF37 | |
IgG | |
84 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title