ARPC5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP189017

Catalog No. NBP189017

Description

ARPC5L Polyclonal specifically detects ARPC5L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ARPC5L
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9BPX5
• Gene Symbols: ARPC5L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: actin related protein 2/3 complex, subunit 5-like, actin-related protein 2/3 complex subunit 5-like protein, ARC16-2MGC3038, Arp2/3 complex 16 kDa subunit 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 81873
• Target Species: Human
• Isotype: IgG

For Research Use Only