Arrestin 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16908320UL

Catalog No. NBP16908320

Description

Arrestin 3 Polyclonal specifically detects Arrestin 3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Arrestin 3
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Alias: arrestin 3, retinal (X-arrestin), arrestin 4, arrestin-C, ARRXcArr, CAR, C-arrestin, Cone arrestin, Retinal cone arrestin-3, X-arrestin
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 20 μL
• Research Discipline: Cell Biology, Cellular Markers, GPCR, Neuroscience, Neurotransmission, Sensory Systems, Signal Transduction, Virology Bacteria and Parasites, Vision
• Gene ID (Entrez): 407
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ARR3
• Immunogen: Synthetic peptides corresponding to ARR3 (arrestin 3, retinal (X-arrestin)) The peptide sequence was selected from the middle region of ARR3. Peptide sequence EDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG