Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Arrestin 3 Antibody, Novus Biologicals™

Arrestin 3 Antibody, Novus Biologicals™
SDP

Catalog No. p-200059323 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392891 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392891 Supplier Novus Biologicals Supplier No. NBP26880225UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Arrestin 3 Polyclonal antibody specifically detects Arrestin 3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Arrestin 3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias arrestin 3, retinal (X-arrestin), arrestin 4, arrestin-C, ARRXcArr, CAR, C-arrestin, Cone arrestin, Retinal cone arrestin-3, X-arrestin
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Biology, Cellular Markers, Neuroscience, Neurotransmission, Sensory Systems, Signal Transduction, Virology Bacteria and Parasites, Vision
Primary or Secondary Primary
Gene ID (Entrez) 407
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.