Arylsulfatase B/ARSB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179727

Catalog No. NBP179727

Description

Arylsulfatase B/ARSB Polyclonal specifically detects Arylsulfatase B/ARSB in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Arylsulfatase B/ARSB
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: arylsulfatase B, ASB, EC 3.1.6.12, G4S, MPS6, N-acetylgalactosamine-4-sulfatase
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 92%; Rat: 92%; Bovine: 85%; Canine: 85%; Guinea pig: 85%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_033842
• Gene Symbols: ARSB
• Immunogen: The immunogen for this antibody is Arsb. Peptide sequence TDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELM.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 411
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.