Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Arylsulfatase B/ARSB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17972720UL
Description
Arylsulfatase B/ARSB Polyclonal specifically detects Arylsulfatase B/ARSB in Mouse samples. It is validated for Western Blot.Specifications
Arylsulfatase B/ARSB | |
Polyclonal | |
Western Blot 1:1000 | |
NP_033842 | |
ARSB | |
The immunogen for this antibody is Arsb. Peptide sequence TDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELM. | |
Affinity Purified | |
RUO | |
411 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
arylsulfatase B, ASB, EC 3.1.6.12, G4S, MPS6, N-acetylgalactosamine-4-sulfatase | |
Rabbit | |
56 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction