Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Arylsulfatase B/ARSB Antibody, Novus Biologicals™
SDP

Catalog No. NBP17972720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17972720 20 μL
NBP179727 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17972720 Supplier Novus Biologicals Supplier No. NBP17972720UL

Rabbit Polyclonal Antibody

Arylsulfatase B/ARSB Polyclonal specifically detects Arylsulfatase B/ARSB in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Arylsulfatase B/ARSB
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_033842
Gene Alias arylsulfatase B, ASB, EC 3.1.6.12, G4S, MPS6, N-acetylgalactosamine-4-sulfatase
Gene Symbols ARSB
Host Species Rabbit
Immunogen The immunogen for this antibody is Arsb. Peptide sequence TDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELM.
Molecular Weight of Antigen 56 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 411
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.