Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Arylsulfatase B/ARSB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | Arylsulfatase B/ARSB |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179727
|
Novus Biologicals
NBP179727 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP17972720
|
Novus Biologicals
NBP17972720UL |
20 μL | N/A | N/A | N/A | ||||
Description
Arylsulfatase B/ARSB Polyclonal specifically detects Arylsulfatase B/ARSB in Mouse samples. It is validated for Western Blot.Specifications
| Arylsulfatase B/ARSB | |
| Polyclonal | |
| Rabbit | |
| NP_033842 | |
| 411 | |
| The immunogen for this antibody is Arsb. Peptide sequence TDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| arylsulfatase B, ASB, EC 3.1.6.12, G4S, MPS6, N-acetylgalactosamine-4-sulfatase | |
| ARSB | |
| IgG | |
| 56 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title