Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASB13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25750125UL
Description
ASB13 Polyclonal specifically detects ASB13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ASB13 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
ankyrin repeat and SOCS box containing 13, ankyrin repeat and SOCS box protein 13, ankyrin repeat and SOCS box-containing 13, ankyrin repeat domain-containing SOCS box protein Asb-13, ASB-13, FLJ13134, MGC19879 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ASB13 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNI | |
25 μL | |
Signal Transduction | |
79754 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction