Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASCL1/Mash1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31768725UL
This item is not returnable.
View return policy
Description
ASCL1/Mash1 Polyclonal antibody specifically detects ASCL1/Mash1 in Human samples. It is validated for ImmunofluorescenceSpecifications
ASCL1/Mash1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
achaete-scute complex (Drosophila) homolog-like 1, achaete-scute complex homolog 1 (Drosophila), achaete-scute complex-like 1 (Drosophila), achaete-scute homolog 1, ASH-1, ASH1MASH1, BHLHA46, bHLHa46achaete-scute complex-like 1, Class A basic helix-loop-helix protein 46, hASH1, HASH1achaete scute protein | |
This antibody was developed against Recombinant Protein corresponding to amino acids: GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL | |
25 μg | |
Neuroscience | |
429 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction