ASK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257164

Catalog No. NBP257164

Description

ASK1 Polyclonal specifically detects ASK1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ASK1
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Apoptosis signal-regulating kinase 1, ASK-1, ASK1MEKK 5, EC 2.7.11, MAP/ERK kinase kinase 5, MAPK/ERK kinase kinase 5, MAPKKK5EC 2.7.11.25, MEK kinase 5, MEKK5apoptosis signal regulating kinase 1, mitogen-activated protein kinase kinase kinase 5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MAP3K5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
• Quantity: 100 μL
• Research Discipline: Apoptosis, Protein Kinase
• Gene ID (Entrez): 4217
• Target Species: Human
• Isotype: IgG

For Research Use Only