Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aspartate Aminotransferase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Aspartate Aminotransferase |
---|---|
Applications | Western Blot, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Aspartate Aminotransferase Polyclonal specifically detects Aspartate Aminotransferase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Aspartate Aminotransferase | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
2805 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLH | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
aspartate aminotransferase, cytoplasmic, EC 2.6.1.1, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), growth-inhibiting protein 18, Transaminase A | |
GOT1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title