Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578827

Invitrogen™ ASPH Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578827
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578827 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578827 Supplier Invitrogen™ Supplier No. PA578827
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Rat Liver Tissue, HELA whole cell, HEPG2 whole cell, HEPA whole cell. IHC: Human Mammary Cancer tissue. ICC/IF: A549 cell. Flow: HeLa cell, U87 cell.

ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins. This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ASPH
Applications Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Asph
Gene Accession No. Q12797, Q8BSY0
Gene Alias 2310005F16Rik; 3110001L23Rik; A beta H-J-J; AAH; AI848629; ASP beta-hydroxylase; Aspartate beta-hydroxylase; aspartate-beta-hydroxylase; aspartyl (asparaginyl) beta hydroxylase; aspartyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase-like; aspartyl/asparaginyl-beta-hydroxylase; ASPH; AW261690; AW561901; BAH; C79816; calsequestrin-binding protein; cardiac junctin; CASQ2BP1; cI-37; FDLAB; HAAH; humbug; JCTN; jumbug; junctate; junctin; junctional sarcoplasmic reticulum protein; peptide-aspartate beta-dioxygenase; Unknown (protein for MGC:137539)
Gene Symbols Asph
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 312981, 444, 65973
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.