Invitrogen™ ASPH Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578827

Catalog No. PIPA578827

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Rat Liver Tissue, HELA whole cell, HEPG2 whole cell, HEPA whole cell. IHC: Human Mammary Cancer tissue. ICC/IF: A549 cell. Flow: HeLa cell, U87 cell.

ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins. This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.

Specifications

• Antigen: ASPH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Asph
• Gene Alias: 2310005F16Rik; 3110001L23Rik; A beta H-J-J; AAH; AI848629; ASP beta-hydroxylase; Aspartate beta-hydroxylase; aspartate-beta-hydroxylase; aspartyl (asparaginyl) beta hydroxylase; aspartyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase-like; aspartyl/asparaginyl-beta-hydroxylase; ASPH; AW261690; AW561901; BAH; C79816; calsequestrin-binding protein; cardiac junctin; CASQ2BP1; cI-37; FDLAB; HAAH; humbug; JCTN; jumbug; junctate; junctin; junctional sarcoplasmic reticulum protein; peptide-aspartate beta-dioxygenase; Unknown (protein for MGC:137539)
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 312981, 444, 65973
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q12797, Q8BSY0
• Gene Symbols: Asph
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov