Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ASPHD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ASPHD2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ASPHD2 Polyclonal specifically detects ASPHD2 in Human samples. It is validated for Western Blot.Specifications
ASPHD2 | |
Polyclonal | |
Rabbit | |
aspartate beta-hydroxylase domain containing 2, aspartate beta-hydroxylase domain-containing protein 2, EC 1.14.11, EC 1.14.11.-, FLJ39838 | |
ASPHD2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
57168 | |
Synthetic peptides corresponding to ASPHD2(aspartate beta-hydroxylase domain containing 2) The peptide sequence was selected from the middle region of ASPHD2. Peptide sequence YCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title