ASPRV1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP233981

Catalog No. NBP233981

Description

ASPRV1 Polyclonal specifically detects ASPRV1 in Human, Canine samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ASPRV1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q53RT3
• Gene Symbols: ASPRV1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GKLKLKAQFLVANASAEEAIIGTDVLQDHNAILDFEHRTCTLKGKKFRLLPVGGSLEDEFDLELIEEDPSSEEGRQELSH
• Quantity: 0.1 mL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 151516
• Target Species: Human, Canine
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: aspartic peptidase, retroviral-like 1, EC 3.4.23.-, FLJ25084, retroviral-like aspartic protease 1, SASPaseMUNO, SASPTAPS, Skin aspartic protease, Skin-specific retroviral-like aspartic protease, Taps, TPA-inducible aspartic proteinase-like protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only