ASRGL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP189133

Catalog No. NBP189133

Description

ASRGL1 Polyclonal specifically detects ASRGL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ASRGL1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: ALP1, ALPL-asparagine amidohydrolase, asparaginase like 1, asparaginase-like 1 protein, Asparaginase-like protein 1, CRASH, EC 3.5.1.1, FLJ22316, L-asparaginase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ASRGL1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQ
• Quantity: 0.1 mL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 80150
• Target Species: Human
• Isotype: IgG

For Research Use Only