Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ASTN2 Antibody, Novus Biologicals™

ASTN2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15919520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15919520 20 μL
NBP159195 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15919520 Supplier Novus Biologicals Supplier No. NBP15919520UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ASTN2 Polyclonal specifically detects ASTN2 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen ASTN2
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml, Immunocytochemistry/Immunofluorescence 1:10-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5JVY1
Gene Alias astrotactin 2, bA264C15.1, bA67K19.1, KIAA0634astrotactin-2
Gene Symbols ASTN2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ASTN2(astrotactin 2) The peptide sequence was selected from the N terminal of ASTN2. Peptide sequence PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23245
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.