Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATAD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ATAD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ATAD1 Polyclonal specifically detects ATAD1 in Human samples. It is validated for Western Blot.Specifications
ATAD1 | |
Polyclonal | |
Rabbit | |
Protein Kinase, Protein Phosphatase | |
AFDC1, ATPase family AAA domain-containing protein 1, ATPase family, AAA domain containing 1, FLJ14600 | |
ATAD1 | |
IgG | |
41 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_116199 | |
84896 | |
Synthetic peptide directed towards the C terminal of human ATAD1The immunogen for this antibody is ATAD1. Peptide sequence KQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVR. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title