Ataxin 1 Antibody (S76-8), DyLight 488, Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP242186G

Catalog No. NBP242186G

Description

Ataxin 1 Monoclonal specifically detects Ataxin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Ataxin 1
• Classification: Monoclonal
• Conjugate: DyLight 488
• Formulation: 50mM Sodium Borate with 0.05% Sodium Azide
• Gene Symbols: ATXN1
• Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Detects approx 85kDa.
• Content And Storage: Store at 4C in the dark.
• Isotype: IgG2b

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
• Clone: S76-8
• Dilution: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
• Gene Alias: ataxin 1, ataxin 1), ataxin-1, ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant, SCA1D6S504E, Spinocerebellar ataxia type 1 protein
• Host Species: Mouse
• Purification Method: Protein G purified
• Research Discipline: Phospho Specific
• Gene ID (Entrez): 6310
• Target Species: Human, Mouse, Rat
• Form: Purified