Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ataxin-1 Monoclonal Antibody (S76-8), QED Bioscience™
SDP

Catalog No. 502278235
Encompass
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
50-227-8235 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. 50-227-8235 Supplier Leinco Technologies Inc Supplier No. 56550100UG
Add to Cart
Add to Cart
This item is not returnable. View return policy

Mouse Monoclonal Antibody

Ataxin-1 Monoclonal antibody specifically detects Ataxin-1 in Human, Mouse, Rat samples. It is validated for Immunocytochemistry, Western Blot

Specifications

Antigen Ataxin-1
Applications Immunocytochemistry, Western Blot
Classification Monoclonal
Clone S76-8
Concentration 1 mg/mL
Conjugate Unconjugated
Formulation PBS with 50% glycerol and 0.1% sodium azide; pH 7.4
Gene ATXN1
Gene Accession No. P54253, P54254, Q63540
Gene Alias 2900016G23Rik; alternative ataxin1; ataxin 1; Ataxin1; ataxin-1; Atx1; Atx-1; Atx-1-PB; Atxn1; C85907; CG4547; CG4547-PB; D6S504E; dAtx-1; Dmel\CG4547; Dmel_CG4547; ENSMUSG00000074917; Gm10786; OTTHUMP00000016065; SCA1; spinocerebellar ataxia 1; spinocerebellar ataxia 1 homolog; spinocerebellar ataxia type 1 protein; Spinocerebellar ataxia type 1 protein homolog
Host Species Mouse
Immunogen Synthetic peptide corresponding to aa 164-197 (ATTPSQRSQLEAYSTLLAN-MGSLSQAPGHKVEPP) of mouse Ataxin-1.
Purification Method Protein A
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20238, 25049, 6310
Target Species Human, Mouse, Rat
Content And Storage -20° C, Avoid Freeze/Thaw Cycles
Product Type Antibody
Form Liquid
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.