Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATCAY Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | ATCAY |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ATCAY Polyclonal specifically detects ATCAY in Human samples. It is validated for Western Blot.Specifications
ATCAY | |
Polyclonal | |
Rabbit | |
Q86WG3 | |
85300 | |
Synthetic peptides corresponding to the C terminal of ATCAY. Immunizing peptide sequence LIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVEN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Ataxia cayman type protein, ataxia, cerebellar, Cayman type, BNIP-H, caytaxin, CLAC, KIAA1872Cayman ataxia | |
ATCAY | |
IgG | |
42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title