Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATCAY Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$492.89
Specifications
| Antigen | ATCAY |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ATCAY Polyclonal specifically detects ATCAY in Human samples. It is validated for Western Blot.Specifications
| ATCAY | |
| Polyclonal | |
| Rabbit | |
| Q86WG3 | |
| 85300 | |
| Synthetic peptides corresponding to the C terminal of ATCAY. Immunizing peptide sequence LIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVEN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Ataxia cayman type protein, ataxia, cerebellar, Cayman type, BNIP-H, caytaxin, CLAC, KIAA1872Cayman ataxia | |
| ATCAY | |
| IgG | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title