Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATCAY Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ATCAY |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP174085
|
Novus Biologicals
NBP174085 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ATCAY Polyclonal specifically detects ATCAY in Human samples. It is validated for Western Blot.Specifications
| ATCAY | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Ataxia cayman type protein, ataxia, cerebellar, Cayman type, BNIP-H, caytaxin, CLAC, KIAA1872Cayman ataxia | |
| ATCAY | |
| IgG | |
| Affinity Purified | |
| 42 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q86WG3 | |
| 85300 | |
| Synthetic peptides corresponding to the C terminal of ATCAY. Immunizing peptide sequence LIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVEN. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title