Invitrogen™ ATF6 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA5114363

Catalog No. PIPA5114363

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat liver tissue, mouse liver tissue, MCF-7 whole cell. IHC: human mammary cancer tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

ATF6 is a transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. It binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. ATF6 could also be involved in activation of transcription by the serum response factor. ATF6 exists as a homodimer and heterodimer with ATF6 beta. The dimer interacts with the nuclear transcription factor Y (NF-Y) trimer through direct binding to NF-Y subunit C (NF-YC). It Interacts also with the transcription factors GTF2I, YY1 and SRF. Under ER stress the cleaved N-terminal cytoplasmic domain translocates into the nucleus. The basic domain of ATF6 functions as a nuclear localization signal and the basic leucine-zipper domain is sufficient for association with the NF-Y trimer and binding to ERSE. During the unfolded protein response an approximately 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases. ATF6 is N-glycosylated, phosphorylated in vitro by MAPK14/P38MAPK and belongs to the bZIP family.

Specifications

• Antigen: ATF6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ATF6
• Gene Alias: 9130025P16Rik; 9630036G24; AA617266; AA789574; ACHM7; activating transcription factor 6; activating transcription factor 6 alpha; Activating transcription factor 6 beta; ATF 6; Atf6; ATF6 alpha; ATF6A; Atf6alpha; ATF6-alpha; Atf6b; ATF6beta; ATF6-beta; cAMP response element binding protein-related protein; cAMP response element-binding protein-related protein; cAMP responsive element binding protein-like 1; cAMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 beta; cAMP-responsive element-binding protein-like 1; Crebl1; Creb-related protein; CREB-RP; Cyclic AMP-dependent transcription factor ATF-6 alpha; cyclic AMP-dependent transcription factor ATF-6 beta; DKFZp686P2194; ESTM49; FLJ21663; G13; Processed cyclic AMP-dependent transcription factor ATF-6 alpha; Processed cyclic AMP-dependent transcription factor ATF-6 beta; Protein G13
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 12915, 1388, 226641, 22926, 304962, 406169
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: F6VAN0, G3V909, O35451, P18850, Q99941
• Gene Symbols: ATF6, ATF6B
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG