Invitrogen™ ATG14 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578833

Catalog No. PIPA578833

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, HELA whole cell. IHC: Rat Spleen tissue, Human Lung Cancer tissue. ICC/IF: U2OS cell. Flow: SiHa cell, A431 cell, PC-3 cell.

ATG14 (Autophagy related protein homolog 14) is encoded by the ATG14 gene and is located on chromosome 14 in humans. It is also known as ATG14L or BARKOR (Beclin 1-associated autophagy-related key regulator). Autophagy is an evolutionarily conserved process that involves recycling of misfolded cellular proteins and degradation of dysfunctional organelles. Autophagy is induced as a cellular response to nutrient stress which includes the formation of autophagosomes, fusion of these with the lysosome and formation of the autophagolysosome. The Class III PI3-Kinase, Vps34 and its interacting partner Beclin 1 have been shown to form a complex which specifically includes ATG 14 (type 1) or UVRAG (type 2). Atg 14 guides the type 1 complex to the preautophagosomal structure (PAS) and is critical for the initiation of autophagosome formation.

Specifications

• Antigen: ATG14
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Atg14
• Gene Alias: 4832427M01; Atg14; ATG14 autophagy related 14 homolog; Atg14L; Atg14-like protein; autophagy related 14; autophagy-related protein 14-like protein; Bakor; Barkor; beclin 1-associated autophagy-related key regulator; Beclin 1-Interacting protein; D14Ertd114e; D14Ertd436e; Kiaa0831; RGD1304610; VATG14 autophagy related 14 homolog
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 22863, 305831
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: D4A4K3, Q6ZNE5
• Gene Symbols: Atg14
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov