Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA578833

Invitrogen™ ATG14 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578833
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578833 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578833 Supplier Invitrogen™ Supplier No. PA578833
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, HELA whole cell. IHC: Rat Spleen tissue, Human Lung Cancer tissue. ICC/IF: U2OS cell. Flow: SiHa cell, A431 cell, PC-3 cell.

ATG14 (Autophagy related protein homolog 14) is encoded by the ATG14 gene and is located on chromosome 14 in humans. It is also known as ATG14L or BARKOR (Beclin 1-associated autophagy-related key regulator). Autophagy is an evolutionarily conserved process that involves recycling of misfolded cellular proteins and degradation of dysfunctional organelles. Autophagy is induced as a cellular response to nutrient stress which includes the formation of autophagosomes, fusion of these with the lysosome and formation of the autophagolysosome. The Class III PI3-Kinase, Vps34 and its interacting partner Beclin 1 have been shown to form a complex which specifically includes ATG 14 (type 1) or UVRAG (type 2). Atg 14 guides the type 1 complex to the preautophagosomal structure (PAS) and is critical for the initiation of autophagosome formation.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATG14
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Atg14
Gene Accession No. D4A4K3, Q6ZNE5
Gene Alias 4832427M01; Atg14; ATG14 autophagy related 14 homolog; Atg14L; Atg14-like protein; autophagy related 14; autophagy-related protein 14-like protein; Bakor; Barkor; beclin 1-associated autophagy-related key regulator; Beclin 1-Interacting protein; D14Ertd114e; D14Ertd436e; Kiaa0831; RGD1304610; VATG14 autophagy related 14 homolog
Gene Symbols Atg14
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 22863, 305831
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.