Atlastin-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159034

Catalog No. NBP159034

Description

Atlastin-3 Polyclonal specifically detects Atlastin-3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Atlastin-3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: atlastin 3, atlastin GTPase 3, atlastin-3, DKFZP564J0863, EC 3.6.5.-
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25923
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6DD88
• Gene Symbols: ATL3
• Immunogen: Synthetic peptides corresponding to DKFZP564J0863 The peptide sequence was selected from the middle region of DKFZP564J0863. Peptide sequence DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Mouse: 100%; Crab-eating macaque: 100%; Bovine: 92%; Streptococcus pneumoniae BS458: 83%; Streptococcus pneumoniae BS457: 83%; Streptococcus pneumoniae BS397: 83%; Streptococcus pneumoniae SP14-BS292: 83%; Streptococcus pneumoniae SP-BS293: 83%; Streptococcus pneumoniae BS455: 83%; Streptococcus mitis SK564: 83%; Streptococcus mitis SK597: 83%; Streptococcus mitis NCTC 12261: 83%; Streptococcus pneumoniae: 83%; Streptococcus pneumoniae MLV-016: 83%; Streptococcus pneumoniae CDC3059-06: 83%; Streptococcus pneumoniae SP3-BS71: 83%; Streptococcus pneumoniae SP6-BS73: 83%; Streptococcus pneumoniae SP9-BS68: 83%; Streptococcus pneumoniae SP11-BS70: 83%; Streptococcus pneumoniae SP14-BS69: 83%; Streptococcus pneumoniae SP18-BS74: 83%; Streptococcus pneumoniae SP19-BS75: 83%; Streptococcus pneumoniae SP23-BS72: 83%; Streptococcus pneumoniae CDC1873-00: 83%; Streptococcus pneumoniae SP195: 83%; Streptococcus pneumoniae CDC0288-04: 83%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG