Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Atlastin-3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159034 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159034 100 μL
NBP15903420 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP159034 Supplier Novus Biologicals Supplier No. NBP159034
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Atlastin-3 Polyclonal specifically detects Atlastin-3 in Human samples. It is validated for Western Blot.

Specifications

Antigen Atlastin-3
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6DD88
Gene Alias atlastin 3, atlastin GTPase 3, atlastin-3, DKFZP564J0863, EC 3.6.5.-
Gene Symbols ATL3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DKFZP564J0863 The peptide sequence was selected from the middle region of DKFZP564J0863. Peptide sequence DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 25923
Test Specificity Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Mouse: 100%; Crab-eating macaque: 100%; Bovine: 92%; Streptococcus pneumoniae BS458: 83%; Streptococcus pneumoniae BS457: 83%; Streptococcus pneumoniae BS397: 83%; Streptococcus pneumoniae SP14-BS292: 83%; Streptococcus pneumoniae SP-BS293: 83%; Streptococcus pneumoniae BS455: 83%; Streptococcus mitis SK564: 83%; Streptococcus mitis SK597: 83%; Streptococcus mitis NCTC 12261: 83%; Streptococcus pneumoniae: 83%; Streptococcus pneumoniae MLV-016: 83%; Streptococcus pneumoniae CDC3059-06: 83%; Streptococcus pneumoniae SP3-BS71: 83%; Streptococcus pneumoniae SP6-BS73: 83%; Streptococcus pneumoniae SP9-BS68: 83%; Streptococcus pneumoniae SP11-BS70: 83%; Streptococcus pneumoniae SP14-BS69: 83%; Streptococcus pneumoniae SP18-BS74: 83%; Streptococcus pneumoniae SP19-BS75: 83%; Streptococcus pneumoniae SP23-BS72: 83%; Streptococcus pneumoniae CDC1873-00: 83%; Streptococcus pneumoniae SP195: 83%; Streptococcus pneumoniae CDC0288-04: 83%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.