Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Atlastin-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15903420UL
Description
Atlastin-3 Polyclonal specifically detects Atlastin-3 in Human samples. It is validated for Western Blot.Specifications
Atlastin-3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q6DD88 | |
ATL3 | |
Synthetic peptides corresponding to DKFZP564J0863 The peptide sequence was selected from the middle region of DKFZP564J0863. Peptide sequence DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
atlastin 3, atlastin GTPase 3, atlastin-3, DKFZP564J0863, EC 3.6.5.- | |
Rabbit | |
Affinity Purified | |
RUO | |
25923 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction