Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP5A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238470
Description
ATP5A Polyclonal specifically detects ATP5A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ATP5A | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
P25705 | |
ATP5F1A | |
This antibody was developed against a recombinant protein corresponding to amino acids: QRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2, ATP sythase (F1-ATPase) alpha subunit, ATP5AL2, ATP5AMOM2, ATPMATP synthase subunit alpha, mitochondrial, cardiac muscle, EC 3.6.3, EC 3.6.3.14, hATP1, mitochondrial ATP synthetase, oligomycin-resistant, OMR, ORMATP synthase alpha chain, mitochondrial | |
Rabbit | |
Affinity Purified | |
RUO | |
498 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction