Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP5S Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25731125UL
Description
ATP5S Polyclonal specifically detects ATP5S in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ATP5S | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
ATP synthase coupling factor B-like 1, ATP synthase subunit s, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit s (factor B), ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B), ATP synthase-coupling factor B, ATPWATP synthase coupling factor B, mitochondrial, HSU79253, Mitochondrial ATP synthase regulatory component factor B | |
Rabbit | |
Affinity Purified | |
RUO | |
27109 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ATP5S | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDC | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction