Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ATP6AP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ATP6AP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ATP6AP1 Polyclonal specifically detects ATP6AP1 in Human samples. It is validated for Western Blot.Specifications
| ATP6AP1 | |
| Polyclonal | |
| Rabbit | |
| Q15904 | |
| 537 | |
| Synthetic peptides corresponding to ATP6AP1 (ATPase, H+ transporting, lysosomal accessory protein 1) The peptide sequence was selected from the middle region of ATP6AP1. Peptide sequence SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 16A, Ac45, ATP6IP1V-ATPase subunit S1, ATP6S1ORF, ATPase, H+ transporting, lysosomal (vacuolar proton pump), subunit 1, ATPase, H+ transporting, lysosomal accessory protein 1, H+ transporting, lysosomal interacting protein 1, H-ATPase subunit, MGC129781, Protein XAP-3, Vacuolar proton pump subunit S1, VATPS1V-ATPase Ac45 subunit, V-type proton ATPase subunit S1, XAP-3, XAP3V-ATPase S1 accessory protein | |
| ATP6AP1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title