Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ATP6AP1L Antibody, Novus Biologicals™

ATP6AP1L Antibody, Novus Biologicals™
SDP

Catalog No. p-7110363 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP191585 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP191585 Supplier Novus Biologicals Supplier No. NBP191585
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ATP6AP1L Polyclonal specifically detects ATP6AP1L in Human samples. It is validated for Western Blot.

Specifications

Antigen ATP6AP1L
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001017971
Gene Alias ATPase, H+ transporting, lysosomal accessory protein 1-like, MGC138396, vacuolar proton pump subunit S1-like protein, V-type proton ATPase subunit S1-like protein
Gene Symbols ATP6AP1L
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human LOC92270. Peptide sequence LHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRS.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 92270
Test Specificity Expected identity based on immunogen sequence: Canine: 92%; Equine: 92%; Pig: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Pig, Canine, Equine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.