Learn More
Description
Specifications
Specifications
| Antigen | ATP6V0A4 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | A4, ATP6N2, ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1B, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38kD), ATPase, H+ transporting, lysosomal V0 subunit a4, MGC130016, MGC130017, noncatalytic accessory protein 1B, RDRTA2, RTA1C, RTADR, STV1, vacuolar proton pump 116 kDa accessory subunit, vacuolar proton pump, subunit 2, vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform, V-ATPase 116 kDa, VPH1, VPP2, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 4 |
| Gene Symbols | ATP6V0A4 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVFVHQAIHTIEYCLGCISNTAS |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
