ATP6V0C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Supplier:  Novus Biologicals NBP159654

Catalog No. NBP159654

Description

ATP6V0C Polyclonal specifically detects ATP6V0C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ATP6V0C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP6CATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD, ATP6LVPPC, ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c, ATPL, H(+)-transporting two-sector ATPase, 16 kDa subunit, vacuolar ATP synthase 16 kDa proteolipid subunit, vacuolar H+ ATPase proton channel subunit, Vacuolar proton pump 16 kDa proteolipid subunit, VATL, V-ATPase 16 kDa proteolipid subunit, Vma3, V-type proton ATPase 16 kDa proteolipid subunit
• Host Species: Rabbit
• Molecular Weight of Antigen: 16 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P27449
• Gene Symbols: ATP6V0C
• Immunogen: Synthetic peptide directed towards the middle region of human ATP6V0C (NP_001685). Peptide sequence VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 527
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine, Rabbit, Sheep
• Isotype: IgG

For Research Use Only