ATP6V1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP155212	Novus Biologicals NBP155212	100 μL

Description

ATP6V1A Polyclonal specifically detects ATP6V1A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ATP6V1A
• Classification: Polyclonal
• Host Species: Rabbit
• Gene Accession No.: P38606
• Gene ID (Entrez): 523
• Immunogen: Synthetic peptides corresponding to ATP6V1A(ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A) The peptide sequence was selected from the N terminal of ATP6V1A. Peptide sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR.
• Primary or Secondary: Primary
• Molecular Weight of Antigen: 68 kDa

• Applications: Western Blot
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Alias: 70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A
• Gene Symbols: ATP6V1A
• Isotype: IgG
• Test Specificity: This product is specific to Subunit or Isoform: A.